PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11171.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 81aa    MW: 9222.47 Da    PI: 10.4812
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11171.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.24.6e-192471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l++++  +G   Wkt+a+  g++R++k+c+ rw++yl
        PK11171.1 24 RGAWTAEEDQKLAEVISHHGAQKWKTVAAIAGLNRCGKSCRMRWLNYL 71
                     89*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.18E-191981IPR009057Homeodomain-like
PROSITE profilePS5129424.821975IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-212181IPR009057Homeodomain-like
SMARTSM007171.4E-132373IPR001005SANT/Myb domain
PfamPF002499.5E-182471IPR001005SANT/Myb domain
CDDcd001675.93E-102671No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MGSSSQSISK PIEEENNFNF KFNRGAWTAE EDQKLAEVIS HHGAQKWKTV AAIAGLNRCG  60
KSCRMRWLNY LRPNIKRGNI T
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008391385.12e-32PREDICTED: transcription factor WER-like
SwissprotP813946e-23MYB15_ANTMA; Myb-related protein 315
TrEMBLQ94FG22e-31Q94FG2_G
STRINGPOPTR_0003s06320.19e-31(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18570.11e-23myb domain protein 51